PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_014454-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family MYB_related
Protein Properties Length: 250aa    MW: 28821.4 Da    PI: 6.8759
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_014454-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.81.9e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEde+l++ ++++G g+W+++++  g+ R++k+c++rw +yl
  AHYPO_014454-RA 14 KGLWSPEEDEKLYNHITRFGVGCWSSVPKLAGLQRCGKSCRLRWINYL 61
                     678*******************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.0E-24764IPR009057Homeodomain-like
PROSITE profilePS5129422.806965IPR017930Myb domain
SuperFamilySSF466891.31E-221197IPR009057Homeodomain-like
SMARTSM007174.9E-121363IPR001005SANT/Myb domain
PfamPF002492.9E-141461IPR001005SANT/Myb domain
CDDcd001671.65E-101761No hitNo description
Gene3DG3DSA:1.10.10.601.1E-1265105IPR009057Homeodomain-like
SMARTSM007170.01466103IPR001005SANT/Myb domain
PROSITE profilePS512948.6666105IPR017930Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 250 aa     Download sequence    Send to blast
MGRHSYSAKQ KMKKGLWSPE EDEKLYNHIT RFGVGCWSSV PKLAGLQRCG KSCRLRWINY  60
LRPDLKRGMF TQEEEDLIIN LHRILGNRTD NEIKNYWNSC LKKKLMKQGI NPETHESLPS  120
QIQPNNNNGF KNTSELTNTN ASVFSSPLQQ PEPASAFVGP SQSYMNMLRP IIESSHQYMT  180
MVPTIINFDD HNFEKEDLGS ESLMFYEGKN GMFSWENQSE NVQFPVNYGG LIKTESLTHD  240
QTSSREEDQL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C6e-201210525128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010678849.11e-94PREDICTED: transcription factor MYB86-like
TrEMBLA0A0K9RHI85e-85A0A0K9RHI8_SPIOL; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G57560.19e-65myb domain protein 50